Protein Info for GFF4481 in Variovorax sp. SCN45

Annotation: 16S rRNA (cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 6 to 303 (298 residues), 324.6 bits, see alignment E=3.7e-101 PF01795: Methyltransf_5" amino acids 6 to 303 (298 residues), 317.3 bits, see alignment E=6.3e-99

Best Hits

Swiss-Prot: 94% identical to RSMH_VARPS: Ribosomal RNA small subunit methyltransferase H (rsmH) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 97% identity to vpe:Varpa_0971)

MetaCyc: 58% identical to 16S rRNA m4C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11638 [EC: 2.1.1.199]

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.199

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF4481 16S rRNA (cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) (Variovorax sp. SCN45)
VTTPWTHTTVLLNEAVEALLSGSTAATGTYVDATFGRGGHARAILSRLAPEGRLIAFDKD
AEAVAEAARISDARFSIRHQGFRSLGELPDASIDGLLMDLGVSSPQIDNPVRGFSFRFDG
PLDMRMDTTRGESVAEWLATAELQQIAEVIRDYGEERFAVQIAKAIVARRQERGPISTTT
ELAELVAGTVKTREQGQNPATRTFQAFRIFINAELEELQQALEASLSVLKPGGRLAVISF
HSLEDRIVKQFIAKHSKEVYDRRAPFAAPKVMKLNALERIKPSQAEVSGNPRSRSAILRV
AERTEAN