Protein Info for GFF4476 in Sphingobium sp. HT1-2

Annotation: Copper/silver efflux RND transporter, membrane fusion protein CusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16576: HlyD_D23" amino acids 113 to 321 (209 residues), 229 bits, see alignment E=8.4e-72 PF16572: HlyD_D4" amino acids 159 to 211 (53 residues), 62.9 bits, see alignment 4e-21 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 217 to 394 (178 residues), 118.4 bits, see alignment E=1.6e-38 PF13437: HlyD_3" amino acids 217 to 318 (102 residues), 57.4 bits, see alignment E=4.6e-19 PF11604: CusF_Ec" amino acids 425 to 492 (68 residues), 78.6 bits, see alignment E=5.1e-26

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 64% identity to sjp:SJA_C1-05240)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>GFF4476 Copper/silver efflux RND transporter, membrane fusion protein CusB (Sphingobium sp. HT1-2)
MSHFTIPRGGLFGAAALLAVAAGGVGFTISEWRGGSPDATAAKPPARKILYWYDPMIPAE
HHDGPGLSSMGMQTIPRYADEVGASAAQPGISIDPSASQALGMRTVAVRRGELASSLTAT
GTIDFNQRDVAIVQARAGGFVSRVYGRAPGDVIGAGAPLADVLVPEWGGAQTEFLAVRRT
GNAALIQAARQRLMLLGMPSGTIASVEQTGRPHNVITISTPTGGVIKTLNVRGGMTLMAG
QTLAEVNGLGTVWLNAAVPEAVAGPLKPGQAVRAALAAFPGETISGRVSAILPETQADSR
TLTVRIELPNRGGRLRPGMFATVSFGGSAQPALLVPSEALIRTGKRTLVMLALDKGRYRP
AEVQTGREAGDDTEILAGLSEGEKIVASGQFLIDSEASLSGVEARPIGADMPKSPAKPMP
TGAVYETVGTIEKITAQSVTLSHQAVPAIGWPAMTMTFQLTDPKVARGLKTGDRVRFGFD
QPPSGPTVRRMAKVMGQ