Protein Info for GFF4474 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 30 to 342 (313 residues), 57 bits, see alignment E=3.3e-19 PF03797: Autotransporter" amino acids 392 to 634 (243 residues), 126.5 bits, see alignment E=1.6e-40

Best Hits

KEGG orthology group: K12686, outer membrane lipase/esterase (inferred from 100% identity to seh:SeHA_C0682)

Predicted SEED Role

"Outer membrane esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>GFF4474 Outer membrane esterase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQKRTLLKYGILSLALAAPLSACAFDSLTVIGDSLSDTGNNGRWTWDSGQNKLYDEQLA
ERYGLELSPSSNGGSNYAAGGATATPELNPQDNTADQVRQWLAKTGGKADHNGLYIHWVG
GNDLAAAIAQPTMAQQIAGNSATSAAAQVGLLLDAGAGLVVVPNVPDISATPMLLEAVIT
AGLGAAAPPALKAALDALAEGATPDFASRQQAIRKALLAAAATVSSNPFIQQLLVEQLLA
GYEAAAGQASALTDYYNQMEEKGLEQHGGNIARADINGLFKEILANPQAFGLTNTVGMAC
PPGVSASACSSAMPGFNASQDYLFADHLHPGPQVHTIIAQYIQSIIAAPVQATYLNQSVQ
SMAQGSRTTLDSRYQQLRQGENPVGSLGMFGGYSGGYQRYDNNEADGNGNHNNLTVGVDY
QLNEQVLLGGLIAGSLDKQHPDDNYRYDARGFQAAVFSHLRAGQAWLDSDLHFLSAKFSN
IQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMVPWLTTGPMLQYAWDYSHVNGYSEK
LNTSTSMRFGDQNAHSQVGSAGWRLDLRHSIIHSWAQINYRRQFGDDTYVANGGLKSTAL
TFSRDGKTQDKNWVDIAIGADFPLSATVSAFAGLSQTAGLSDGNQTRYNVGFSARF