Protein Info for GFF4472 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized protein ybdG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details PF21088: MS_channel_1st" amino acids 143 to 184 (42 residues), 23.1 bits, see alignment 8.9e-09 PF00924: MS_channel_2nd" amino acids 185 to 253 (69 residues), 63.1 bits, see alignment E=3.2e-21 PF21082: MS_channel_3rd" amino acids 330 to 397 (68 residues), 43.3 bits, see alignment E=6.2e-15

Best Hits

Swiss-Prot: 89% identical to YBDG_SHIFL: Miniconductance mechanosensitive channel YbdG (ybdG) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to sew:SeSA_A0736)

Predicted SEED Role

"Uncharacterized protein ybdG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF4472 Uncharacterized protein ybdG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQELISRVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIVLRAFEKRASASSRLWL
QIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTCAQLWIMTYALLSLFSLLD
VIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLLIGQSPAILISGLGAMAAVLM
LVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIP
TWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHFLDDDEKQRLLTAQLLKPYLTSRHQ
EIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEYLRHHPRIRKDMTLMVRQLAPDDHGLP
IEIYAFTNTVVWLEYESIQADIFDHIFAVVEEFGLRIHQTPTGSDIRALSGTLRH