Protein Info for GFF447 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 66 to 93 (28 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 239 (146 residues), 60.5 bits, see alignment E=9.6e-21

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 75% identity to xau:Xaut_4037)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF447 hypothetical protein (Xanthobacter sp. DMC5)
MAVPARPYSPALLSAIWGMAGLLALAGAWQWGAVAFGPFVLPSLAETGEAVVRLVATGKA
GPALLATLVHALAGCAAGGAVGFLLGVAGGLALPVGAMSYPVFTALLGTPPIAWVVLALL
WFGPGGGAATFTVAITAAPILFIATLQGVRSRDRGLAEMAQLYRAPPFMRFTDLVLPALA
DFLIPALATALAFSFKVAVMAEVLSGADGVGGGIATARSHFDLPETMAWIVLAIAVLILA
DALLLAPLRRRRAGRGAPARLSAEA