Protein Info for PS417_22865 in Pseudomonas simiae WCS417

Annotation: CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 169 to 185 (17 residues), see Phobius details PF02515: CoA_transf_3" amino acids 8 to 374 (367 residues), 388.8 bits, see alignment E=1.4e-120

Best Hits

Swiss-Prot: 52% identical to SCCT_CHLAA: Succinyl-CoA--D-citramalate CoA-transferase (Caur_2266) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K07749, formyl-CoA transferase [EC: 2.8.3.16] (inferred from 94% identity to pfs:PFLU5001)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.16

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMV6 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PS417_22865 CoA-transferase (Pseudomonas simiae WCS417)
MSFNAKPLAGLKVIELGTLIAGPFASRICAEFGAEVIKVESPDGGDPLRKWRKLYEGTSL
WWFVQARNKKSLTLNLKHPDGLAILKQLLADADILIENFRPGVLEKLGLSWETLHALNPK
LVMVRLSGFGQTGPMKDQPGFGAVGESMGGLRYITGFEDRPPVRTGISIGDSIAALWAVI
GALMALRHREVNGGQGQVVDVALYEAIFAMMESMIPEFDVFGFIRTGNIMPGITPSSIHT
SADGKHVQIGANGDAIFKRFMLAIGREDLANDPELASNDGRDGRRDELYGVIDRWVNSLS
LDQVVEQLNQAEVPASRIYSAEDMLGDPQFLAREMFLKAKLPGGKDFKMPGIVPKLSDTP
GSCEWVGPQLGEHNNVLLNELGYDEAAITRLREQGAI