Protein Info for GFF4462 in Xanthobacter sp. DMC5

Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 18 to 162 (145 residues), 72.1 bits, E=2.4e-24

Best Hits

Swiss-Prot: 78% identical to RPPH_AZOC5: RNA pyrophosphohydrolase (rppH) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 80% identity to xau:Xaut_2145)

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (177 amino acids)

>GFF4462 RNA pyrophosphohydrolase (Xanthobacter sp. DMC5)
MSKKHHEGKHEKHEDAPYRPCVGLCVFNAAGKVFVGRRLGGPEHVDATHSWQMPQGGIDK
GEEPYAAALRELYEETSIRSVTKLGEVEQWLSYDLPGRIAGEAWKGRYRGQTQKWYALRF
TGADGEINILRPGGGQHKPEFMDWRWEDLDAVVDLIIPFKRDVYVEVVKQFRRFAQG