Protein Info for GFF4461 in Sphingobium sp. HT1-2

Annotation: Multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF07732: Cu-oxidase_3" amino acids 127 to 240 (114 residues), 106.5 bits, see alignment E=9.7e-35 PF07731: Cu-oxidase_2" amino acids 445 to 559 (115 residues), 87 bits, see alignment E=9.9e-29

Best Hits

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>GFF4461 Multicopper oxidase (Sphingobium sp. HT1-2)
MIDQLARAATSLEGQFCLPRGGGHKSDRFGYYGYCPPARPLREERRFASVDLIGIEKSAL
ASVSRLLRRGFEMTFLNRRTLLAGGGLLLGAACTRRFATPDQAGTLPIPRLLDARDHGQR
IGLRAQEGETTFFPGRRSATMGYNGSYLGPTLRVHRGDDVTVTVSNNLSADTTVHWHGLL
VPGELDGSPHQTISPGETWRPTLPIRQPAATLFYHSHAHGQTAEQVYAGLAGLLFVTDEE
EQGLGLPSDYGVDDLPILIQDRQFVDGRLVLPAGMMVALDGRRGNVILVNGAYNPRADVP
RSLVRLRLVNGSNARTYDLSFSDGRAFYWIGTEGGLLEKSVELQSLPLASGQRAEILVDF
SDGRPVSLVSAPDQSTLRMHGMSMMHRHEASENNAGNETVLTFSPRLASSKRGSTTLPLL
LASRAVPDPATVVARRRLVLNMRLGGMMDSDEEPLTINHRRFDMDRIDEEVELGAVEIWK
VSGQKMAHPFHIHGVHFDVLSRDGEEPDLLDQGPRDTIVVDEPVELLIRFDQPASKAPFL
FHCHILEHEDEGMMGQFSVT