Protein Info for GFF4460 in Variovorax sp. SCN45

Annotation: Phosphatidate cytidylyltransferase (EC 2.7.7.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF01148: CTP_transf_1" amino acids 62 to 324 (263 residues), 99.9 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 96% identity to vpe:Varpa_0988)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF4460 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (Variovorax sp. SCN45)
MNQFLRNLTPTQQVAALFLIVFGLLAIVSATAFFLTFRERRNPVHDAAWQAELAHFRALL
GTTWFMVVIFWIGWALGETVATVLFALISFFALREFITLSPTRRGDHRSLILAFFVVLPI
QFWLVATARFDLFTVFIPVYVFLAIPVTSALANDPSQFLERNAKLQWGIMVCVYGMSHVP
ALLLLSFPGYEGKSAFLVFFLVFVVQTSVLVQHLISRRTQRAPFAPNVSRSFNWTSWGIG
IVVASLVGALFSFITPFKFGQALAVSVIACIAGSMGHLVMKALKRDRGIPNWGKKGVGVT
GANGLLDRVDALCFAAPIFFHSIRWYFNA