Protein Info for GFF4457 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 64 to 75 (12 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 406 (25 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 459 to 476 (18 residues), see Phobius details amino acids 534 to 557 (24 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 434 (397 residues), 101.5 bits, see alignment E=2.4e-33

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_1293)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>GFF4457 hypothetical protein (Xanthobacter sp. DMC5)
MSVTTFAPPPFLSRERTIASASFNRWLVPPAALAIHLCIGMAYGFSVFWLPLSRAVGVTK
PVACPADMSFVAGLFATSCDWQISQLGWMYTLFFVLLGSSAAIWGGWLETAGPRKAGLVS
AFCWCGGLVISALGVYLHQIWMLWIGSGVIGGIGLGLGYISPVSTLIKWFPDRRGMATGM
AIMGFGGGAMIGAPLANMLMQYFVTPTSVGVWQTFLAMAAIYFVFMVGGALGYRVPREGW
APKGWTPPAASANAMVTHRHVHLDVAWKTPQFWLLWAVLCLNVSAGIGVIGMASPMLQEV
FGGKLIGLDLTFSQLDAGQKAQIAAIAAGFTGLLSLCNIGGRFAWASFSDKLGRKMTYAV
FFVLGFALYASIPSLAHMGSVVLFVAAFCIILSMYGGGFATIPAYLADIFGTHMVGAIHG
RLLTAWATAGIIGPVLVNYLREYQIASGIPQQAAYDQTMYILSGLLVVGLVANLLVKPVA
EHLYMKDDELKKKATQVAREDATHADFEDFEEEAKDGPLAASARSSTPVASGTTALPVVV
LAWLVVGLPLAWGIWITLQKAVILFR