Protein Info for GFF4456 in Variovorax sp. SCN45

Annotation: Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 3 to 281 (279 residues), 225.6 bits, E=3.2e-71
• PF08501: Shikimate_dh_N
  • amino acids 6 to 94 (89 residues), 64.8 bits, E=1e-21
• PF01488: Shikimate_DH
  • amino acids 123 to 203 (81 residues), 37.2 bits, E=4.7e-13
• PF18317: SDH_C
  • amino acids 248 to 278 (31 residues), 44.6 bits, 1.4e-15

Best Hits

Swiss-Prot: 65% identical to AROE_METPP: Shikimate dehydrogenase (NADP(+)) (aroE) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 90% identity to vpe:Varpa_0992)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (290 amino acids)

>GFF4456 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25) (Variovorax sp. SCN45)
MDLYCVIGNPVEHSRSPRIHARFAELCGQQMDYGRRLVPIGAFAEGIAAFRAEAAERGDT
ARGCNITVPFKFEAAALAQHTSERATLAQAVNTLRFEADGGIHADNTDGIGLVNDIVRNA
GVPLQGKALLLIGAGGAAAGVLGPLLDAGAARVVVANRTVDKAIELVRRHAAVALRHGAS
LEAWALDKVPGAFDVVVNATASSLAGDAVPVSADVLRPGGLAVDMMYGPAAAGFMAWAEA
HGAVARDGLGMLVEQAAESFEIWRGVRPPSAQVLAELRSSLAAAAATAKA