Protein Info for GFF4453 in Xanthobacter sp. DMC5

Annotation: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF01209: Ubie_methyltran" amino acids 33 to 264 (232 residues), 270.6 bits, see alignment E=3.1e-84 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 37 to 263 (227 residues), 261.1 bits, see alignment E=3.3e-82 PF13489: Methyltransf_23" amino acids 76 to 246 (171 residues), 35.7 bits, see alignment E=2.1e-12 PF13847: Methyltransf_31" amino acids 81 to 201 (121 residues), 66.3 bits, see alignment E=8.3e-22 PF08242: Methyltransf_12" amino acids 83 to 180 (98 residues), 48.5 bits, see alignment E=3.7e-16 PF08241: Methyltransf_11" amino acids 83 to 182 (100 residues), 69.3 bits, see alignment E=1.1e-22 PF13649: Methyltransf_25" amino acids 83 to 179 (97 residues), 73.7 bits, see alignment E=4.8e-24

Best Hits

Swiss-Prot: 67% identical to UBIE_BRADU: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 82% identity to xau:Xaut_2016)

MetaCyc: 53% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Cereibacter sphaeroides)
RXN-9235 [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>GFF4453 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Xanthobacter sp. DMC5)
MTDFNSAPATGDETRGTSADTHFGYRTVPLAEKQALVDDVFHKVARRYDIMNDLMSGGLH
RAWKDALVSKVRPPQGARPFHLLDLAGGTGDVSFRVVEAGGPGTDAIVADINTDMLAVGR
ERAEKRGLADRVAFQEANAEALPFPDMSFDAVTIAFGIRNVPRIDLALREMRRVLKPGGR
AFVLEFSKVDVPLLDKVYDAFSFRVIPQIGKRVAGDAEPYQYLVESIRRFPTAEAFAGMM
REAGFARVTFTRMTGGVVALHSGFRI