Protein Info for PS417_22755 in Pseudomonas simiae WCS417

Annotation: acriflavine resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1008 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 462 to 488 (27 residues), see Phobius details amino acids 521 to 542 (22 residues), see Phobius details amino acids 845 to 865 (21 residues), see Phobius details amino acids 872 to 892 (21 residues), see Phobius details amino acids 899 to 922 (24 residues), see Phobius details amino acids 948 to 970 (23 residues), see Phobius details amino acids 977 to 1002 (26 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1002 (999 residues), 925.3 bits, see alignment E=6.7e-282 PF03176: MMPL" amino acids 292 to 491 (200 residues), 37.5 bits, see alignment E=2.1e-13 amino acids 847 to 1003 (157 residues), 21.4 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 45% identical to Y895_HAEIN: Uncharacterized transporter HI_0895 (HI_0895) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU4979)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMT7 at UniProt or InterPro

Protein Sequence (1008 amino acids)

>PS417_22755 acriflavine resistance protein B (Pseudomonas simiae WCS417)
MKFTDVFIRRPVLAMVVSLLIVLLGFQAYSTLPLRQYPSMENALITVTTAYPGANAETIQ
GYITQPLQQSLASAEGIDYMTSVSRQNFSVISIYARIGSNSDRLFTELLAKANEVKNKLP
QDAEDPVLSKEAADASALMYISFSSGQLSNPQITDYLSRVIQPKLATLPGMAEAEILGNQ
VFAMRIWLDPVKLAGFGLSASDITDAVRRYNFLSAAGEVKGEFVVTSINANTDLKSAEAF
GAISVKTDGDSRVLLRDVARVEMGAENYNAISSFGGTPSVYIGIKATPSANPLDVIKEVR
KILPELESQLPPNLKAEIAYDATLFIQASINEVVKTLFEAVLIVIVVVFLFLGALRSVVI
PVITIPLSMIGVLFFMQLMGYSINLLTLLAMVLAIGLVVDDAIVVVENIHRHIEEGKTPL
DAALEGAREIALPVVSMTITLAAVYAPIGFLEGLTGALFKEFALTLAGAVIISGIVALTL
SPMMCALLLRHDENPSGLAHRLDRMFDGLKRRYQRMLHGTLNTRPVVIVFALIVLCLIPV
FLKFTQSQLAPDEDQGIIFMIASAPQPTNLEYLNTYTDEFINIFKAFPEYYSSFQINGFN
GVQSGIGGFLLKPWNERDRTQMQILPEVQKRLEQIPGLQVFGFNLPSLPGTGEGLPFGFV
INTANDYESLLEVANRVKKRAMESGKFAFVDIDLAFDKPEVVVDIDRAKAAQMGVSMQDL
GGTLATLLAEAEINRFTLDGRSYKVIAQVERTYRDNPEWLNNYYVKNAQGEVLPLSTLIT
VTDRARPRQLNQFQQLNSALISGFPIVSMGEAIDTVRQIAIEETPPGYAFDYSGASRQFI
QEGTALWATFGLALAIIFLVLAAQFESFRDPLVILVTVPLSICGALIPLFLGWSSMNIYT
QVGLVTLIGLISKHGILIVEFANQLRKDKGLTPRQAVEEAAAIRLRPVLMTTAAMVFGMV
PLILATGAGAVSRFDIGMVIATGMSIGTLFTLFVLPCVYTLLAKPDKA