Protein Info for GFF4444 in Sphingobium sp. HT1-2

Annotation: short-chain dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF01370: Epimerase" amino acids 6 to 138 (133 residues), 27.1 bits, see alignment E=7e-10 PF08659: KR" amino acids 6 to 163 (158 residues), 26.9 bits, see alignment E=1.1e-09 PF00106: adh_short" amino acids 6 to 188 (183 residues), 137 bits, see alignment E=1.5e-43 PF13460: NAD_binding_10" amino acids 9 to 139 (131 residues), 40.3 bits, see alignment E=8.1e-14 PF13561: adh_short_C2" amino acids 9 to 196 (188 residues), 96.6 bits, see alignment E=4.3e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to sjp:SJA_C1-05000)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF4444 short-chain dehydrogenase/reductase (Sphingobium sp. HT1-2)
MSNHWFLTGASSGIGRHLAELILAAGDDLTATARKPESLDDLAAKYPSQLRVEALDVTVK
DDIAAVVARAQARRPVDILVNNAGGGVIGATEEMSNAEVEGQIALNLMAPIHITRAFVPA
MRLRGSGRIIQISSASGQGSLPTSSLYHVAKWGLEGFSECLRQELEPFNLFVTLIEPGGA
RTSFSHNLQFASEIAAYRDTPAGHIRKMFETAGNELYTLDPQKIAQAIVDVATSDHPPLR
VTLGGDAFGVVQAALQSRLAFLQSQEALARSVAFDS