Protein Info for GFF4442 in Xanthobacter sp. DMC5

Annotation: putative Ni/Fe-hydrogenase B-type cytochrome subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 34 to 246 (213 residues), 245 bits, see alignment E=2.8e-77 PF01292: Ni_hydr_CYTB" amino acids 35 to 239 (205 residues), 107.5 bits, see alignment E=3.7e-35

Best Hits

Swiss-Prot: 62% identical to CYBH_AZOCH: Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hupZ) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 87% identity to xau:Xaut_2175)

MetaCyc: 62% identical to hydrogenase b-type cytochrome subunit (Cupriavidus necator)
Hydrogenase (acceptor). [EC: 1.12.99.6]

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF4442 putative Ni/Fe-hydrogenase B-type cytochrome subunit (Xanthobacter sp. DMC5)
MTDTSLSPGTAPPAASPTEVARVIAGGKKLTTVYVYEAPVRLWHWVNALSILVLCVTGYF
IGSPFPTLSGEASAHYLMGTIRFVHFAAGYILAVGFLGRIIWAFFGNKYSRELFTFPFWR
KSFWKGFFTEVQWYAFLKPRPLKFVGHNPLAQVFLFFVMVLGLAFMILTGFALYSEGTGL
GSWQAKLFGWVIPLLGGSMQVHTLHHLGMWVIIVFIIIHVYSVIREDIMSRQSMVSAITN
GHRTFRDDDPD