Protein Info for PS417_22700 in Pseudomonas simiae WCS417

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 160 (146 residues), 92.3 bits, see alignment E=1.3e-30 PF04542: Sigma70_r2" amino acids 16 to 74 (59 residues), 46.3 bits, see alignment E=7.5e-16 PF07638: Sigma70_ECF" amino acids 53 to 160 (108 residues), 35.4 bits, see alignment E=2.6e-12 PF08281: Sigma70_r4_2" amino acids 110 to 159 (50 residues), 55.1 bits, see alignment E=1.2e-18 PF04545: Sigma70_r4" amino acids 116 to 152 (37 residues), 33.6 bits, see alignment 5.6e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU4966)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8C7 at UniProt or InterPro

Protein Sequence (172 amino acids)

>PS417_22700 RNA polymerase subunit sigma-24 (Pseudomonas simiae WCS417)
MSQSRFNHVFLTQRVMLLRTLQRMVNNHSTAEDLLQETYLRVTRALSERPIDHLEPFVYQ
TARNLALDHLRARRIQARTLQENVPLDVLQSVAAPISTPEDATQAEQMLEALSVSLGQLS
ARQQRIFILSRLHGCSYQEIADQLGVSLSTVQKELKLIMAICVGVAERLDRP