Protein Info for PS417_22685 in Pseudomonas simiae WCS417

Updated annotation (from data): Glucokinase (EC 2.7.1.2)
Rationale: Specifically important for utilizing D-Trehalose dihydrate. Automated validation from mutant phenotype: the predicted function (GLUCOKIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00749: glucokinase" amino acids 5 to 310 (306 residues), 258.9 bits, see alignment E=3.4e-81 PF02685: Glucokinase" amino acids 5 to 315 (311 residues), 357.6 bits, see alignment E=2.6e-111

Best Hits

Swiss-Prot: 55% identical to GLK_PSEAE: Glucokinase (glk) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 98% identity to pfs:PFLU4963)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UR28 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PS417_22685 Glucokinase (EC 2.7.1.2) (Pseudomonas simiae WCS417)
MKLALVGDIGGTNARFALWRDQELHSIRVHATADHSSPEDAIKVYLKEEGLEIGDIGAVC
LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYT
EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW
LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFINSGFAKSFADKGCMSDYFKGIPVWLVT
APYSGLTGAGVALEQAFA