Protein Info for GFF4431 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ureidoglycine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03214: putative allantoin catabolism protein" amino acids 3 to 260 (258 residues), 396 bits, see alignment E=3.6e-123 PF05899: Cupin_3" amino acids 56 to 136 (81 residues), 41.8 bits, see alignment E=1e-14 PF07883: Cupin_2" amino acids 184 to 230 (47 residues), 31.1 bits, see alignment 2.4e-11

Best Hits

Swiss-Prot: 92% identical to ALLE_ECOLI: (S)-ureidoglycine aminohydrolase (allE) from Escherichia coli (strain K12)

KEGG orthology group: K14977, ureidoglycine aminohydrolase [EC: 3.5.3.-] (inferred from 99% identity to sei:SPC_0540)

MetaCyc: 92% identical to (S)-ureidoglycine aminohydrolase (Escherichia coli K-12 substr. MG1655)
URUR-RXN [EC: 3.5.3.26]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.- or 3.5.3.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF4431 Ureidoglycine aminohydrolase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFENCDVTILSTPKLGASFV
DYLVTLHQNGGNQQGFGGEGIETFLYVIAGNIEAKAEGKTFSLTQGGYLYCPPGEMMTFS
NAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYEGMEDVILLDFLPKELGFDMN
MHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNNWVPVKKGDYIFMGAYSLQAGYG
VGRGEAFSYIYSKDCNRDVMI