Protein Info for GFF4429 in Xanthobacter sp. DMC5

Annotation: Carbamoyl dehydratase HypE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR02124: hydrogenase expression/formation protein HypE" amino acids 25 to 360 (336 residues), 448.7 bits, see alignment E=5.5e-139 PF00586: AIRS" amino acids 69 to 174 (106 residues), 81.2 bits, see alignment E=7.9e-27 PF02769: AIRS_C" amino acids 186 to 337 (152 residues), 101.4 bits, see alignment E=5.8e-33

Best Hits

Swiss-Prot: 63% identical to HYPE_RHOCA: Carbamoyl dehydratase HypE (hypE) from Rhodobacter capsulatus

KEGG orthology group: K04655, hydrogenase expression/formation protein HypE (inferred from 86% identity to xau:Xaut_2187)

MetaCyc: 56% identical to carbamoyl dehydratase HypE (Escherichia coli K-12 substr. MG1655)
4.2.1.M8 [EC: 4.2.1.M8]; RXN-22648 [EC: 4.2.1.M8]

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypE" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.M8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF4429 Carbamoyl dehydratase HypE (Xanthobacter sp. DMC5)
MNIPIAIPVSTPAAARRRPMTQKIVTLAHGGGGSAMRDLIDDVFLSAFSGAGRAAPEDQA
RFDLSALMAHGDRLAFTTDGFVVDPLFFPGGDIGKLAVCGTVNDLAVGGAKPVALSCAII
IEEGLEVETLRRVVHSMAETAHAAGVDIATGDTKVVARGACDKLFITTTGIGVIRTGLDV
GVTKARPGDRVIVNGLLGDHGAAILNARGDLALETAIASDCAPLNGLIDTLIAAAPGLRM
MRDATRGGIAAVVNELAEASKVGIRLDELSLPMRPEVMGFCEILGLDPLYLANEGKILAV
VPAGETDAALAALRAHPLGREAAVIGEVTSERPGRVVMRTRFGGERIVDMLVGDQLPRIC