Protein Info for GFF4426 in Xanthobacter sp. DMC5

Annotation: Protein YhgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 PF09371: Tex_N" amino acids 11 to 84 (74 residues), 105.2 bits, see alignment E=4.7e-34 PF22706: Tex_central_region" amino acids 139 to 314 (176 residues), 217.9 bits, see alignment E=4.2e-68 PF16921: Tex_YqgF" amino acids 331 to 460 (130 residues), 170 bits, see alignment E=1.2e-53 PF14635: HHH_7" amino acids 478 to 566 (89 residues), 27.8 bits, see alignment E=1.1e-09 PF12836: HHH_3" amino acids 500 to 564 (65 residues), 92.8 bits, see alignment E=4.4e-30 PF17674: HHH_9" amino acids 570 to 639 (70 residues), 84.5 bits, see alignment E=3e-27 PF23459: S1_RRP5" amino acids 657 to 727 (71 residues), 30.3 bits, see alignment E=2e-10 PF00575: S1" amino acids 658 to 729 (72 residues), 76.8 bits, see alignment E=5.5e-25

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 91% identity to xau:Xaut_2166)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (789 amino acids)

>GFF4426 Protein YhgF (Xanthobacter sp. DMC5)
MAAAPQGNADAIARLIAAEINARPAQVTAAVSLIDEGATVPFIARYRKEVTGGLDDTQLR
TLEERLSYLRELESRRAAVLSSIDGQGKLSDELRGKIEAATTKAELEDLYLPYKPKRRTK
AEIAREKGLGPLAEAILADRSVAPAERAAAFLNEQVADIKAALDGARDILVETFAENAEL
VGRLRGHLKANAMLKAKVAEGKEEAGAKFRDYFDHSEKWATAPSHRVLAMLRGRNEEMLT
LDLVVDEDATTPVKPAERIVAEAYDIPLANGAPADGFLLEVARWAWRVKLSLHLTVELMG
EMRERAEEEAIRVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVAVVDGTGKLIATSTV
YPFQPRNDVQGAMAELAHLIRRHNVELIAIGNGTASRETDKLAADMIAALPPDASGKKPI
KVVVSEAGASVYSASATAAAEMPDIDVSIRGAVSIARRLQDPLAELVKIEPKAIGVGQYQ
HDVDQARLAKTLDAVVEDAVNAVGVDLNTASASLLARVSGLGASLAEAIVAHRNSVGAFK
TRKELLKVSRLGPRTFELAAGFLRIPDGAEPLDASAVHPEAYEVAKKIVAACGRDVRQIM
GDTAALKALDPRAFVDERFGLPTVRDILTELEKPGRDPRPAFKTATFAEGVHEMSDLKPG
MVLEGTVTNVAAFGAFVDIGVHQDGLVHVSALADRFVKDPHEVVKAGDVVKVRVVEVDVK
RKRIALSMRKDDAGASRPAGGRPDQPRNDLRGNDARRPQPSKPGDKGGDKGGQGAFGAAL
AEAMRRKGQ