Protein Info for GFF4425 in Sphingobium sp. HT1-2

Annotation: LysR-family transcriptional regulator similar to hydrogen peroxide-inducible genes activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00126: HTH_1" amino acids 4 to 63 (60 residues), 72.8 bits, see alignment E=1.8e-24 PF03466: LysR_substrate" amino acids 88 to 291 (204 residues), 143.1 bits, see alignment E=8.3e-46

Best Hits

Swiss-Prot: 41% identical to OXYR_ECOLI: Hydrogen peroxide-inducible genes activator (oxyR) from Escherichia coli (strain K12)

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 62% identity to eli:ELI_02280)

MetaCyc: 41% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF4425 LysR-family transcriptional regulator similar to hydrogen peroxide-inducible genes activator (Sphingobium sp. HT1-2)
MPTLRQLEYLVALADLRHFGRAAQASHVSQPSLSQQLRALEQRLGTVLVERNQGSVELTP
IGRELAERARGVLVAVEDMRELARRAQEGNAGTIRFGVTPTLGPYLMSNVILALHRQQPG
LRLYIREGIPDEQALELARGQLDMLLGPLPIAGEGAIVEPLFRERLRLVAAPDHPLAQRP
VLRKSDLKGAQVLSLHSAHHLHRQVAGFCMELGMELLRDYEGTSLDSLRQMAATGLALTI
LPDLYIRSEVGGSAGVKVLEVKNWQPTRSIAAAWRHGAAFADAYARIAECVRCEALTIVG
A