Protein Info for GFF4417 in Sphingobium sp. HT1-2

Annotation: Alkyl hydroperoxide reductase subunit C-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 14 to 143 (130 residues), 122.6 bits, E=9.9e-40
• PF08534: Redoxin
  • amino acids 15 to 152 (138 residues), 68.6 bits, E=5.4e-23

Best Hits

Swiss-Prot: 41% identical to TDXH_THEVO: Peroxiredoxin (TV1123) from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 59% identity to gdj:Gdia_2700)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15

Protein Sequence (207 amino acids)

>GFF4417 Alkyl hydroperoxide reductase subunit C-like protein (Sphingobium sp. HT1-2)
MIEAAASMPSAIRIGDAAPDFQARSTRGEFQLSKLRGHWVLLFSHPADFTPVCSTEFVAL
ARRQAEFEALGCKLVGVSVDSLYAHIAWVRALKDLFEVEIGFPIIEDPSMAVGRAYGMIG
ENAADSMAMRSTFFIDPQGVVRATTAYPHNVGRSVDELLRLLRALKCVDEKDVLTPEGWT
EGEAALLPVDDQTSGARDWFCRFEPQP