Protein Info for GFF4415 in Xanthobacter sp. DMC5

Annotation: Nicotinate-nucleotide pyrophosphorylase [carboxylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01334: modD protein
  • amino acids 7 to 277 (271 residues), 257.4 bits, E=8.5e-81
• PF02749: QRPTase_N
  • amino acids 23 to 106 (84 residues), 48.5 bits, E=8.4e-17
• PF01729: QRPTase_C
  • amino acids 108 to 275 (168 residues), 117.1 bits, E=7.1e-38

Best Hits

Swiss-Prot: 34% identical to MODD_HAEIN: Putative pyrophosphorylase ModD (modD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 82% identity to xau:Xaut_0148)

Predicted SEED Role

"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Protein Sequence (280 amino acids)

>GFF4415 Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Xanthobacter sp. DMC5)
MTYRWWTQAMVDALLAEDAPYGDLTTESLGLAGRDARLSMAVRGETTLCGVELARDLFLT
AGAKADLLAASGARVPQGDTFLLAEGAAGPIFRAWKVAQTLVEYLSGIATLTADIVAAAR
AVSPEVAVVTTRKTLPGAKAQMIAAIRAGGAFPHRLGLSETLLLFPEHAAFLADPAEGIA
RLRRQAPEKKVVVEVKTPEEAEAVLPARPDVLQCEKMTPDDIRQVVAVTAQRSPGTKVAA
AGGVNLSNAAAYAAAGAHVLVTSAPYWAKPADVKVVIAPA