Protein Info for GFF4414 in Xanthobacter sp. DMC5

Annotation: 2-phosphonomethylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR02660: homocitrate synthase" amino acids 33 to 395 (363 residues), 507.4 bits, see alignment E=1.3e-156 PF00682: HMGL-like" amino acids 35 to 288 (254 residues), 274 bits, see alignment E=1.3e-85 PF22617: HCS_D2" amino acids 304 to 380 (77 residues), 71.1 bits, see alignment E=8.6e-24

Best Hits

Swiss-Prot: 52% identical to NIFV_AZOVI: Homocitrate synthase (nifV) from Azotobacter vinelandii

KEGG orthology group: K01655, homocitrate synthase [EC: 2.3.3.14] K02594, homocitrate synthase NifV (inferred from 88% identity to xau:Xaut_0150)

MetaCyc: 52% identical to homocitrate synthase monomer (Azotobacter vinelandii)
Homocitrate synthase. [EC: 2.3.3.14]

Predicted SEED Role

"Homocitrate synthase (EC 2.3.3.14)" in subsystem Nitrogen fixation (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF4414 2-phosphonomethylmalate synthase (Xanthobacter sp. DMC5)
MLAKSPSVTSGRSGRALAEAGGSAKGAAATRTVFLNDTTLRDGEQAPGVAFTRKEKIEIA
EALAAAGVPEIEAGTPAMGDEEIETLRSIVSLKLPLRVAAWCRMSEEDLFAAVSAGVNYV
NLSIPTSDRQLQGKLNRDREWALAALKHVATLATKLGFTVAIGCEDASRADPDFLCRVAE
AAREAGAFRLRLADTLGVLDPFSTYALVRRVANATDLEIEFHAHDDLGLATANTLAAVTG
GARHASVTVVGLGERAGNAALEEVAIALRQTARAESGIDPRALRPLAEKVMAAAGRAMPR
TKAIVGEDVFTHESGIHVSGLLKDRGTYEALNPELLGRSHRVVLGKHSGLAAISKALADE
GLAVDEARGRAILARVRDFSVRTKETVTPQVLRRFYEDSFTEEALKRRHAAVMGA