Protein Info for GFF4414 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00809136: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 243 to 263 (21 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 403 to 429 (27 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 680 to 700 (21 residues), see Phobius details amino acids 729 to 755 (27 residues), see Phobius details amino acids 769 to 790 (22 residues), see Phobius details PF02687: FtsX" amino acids 247 to 364 (118 residues), 46.6 bits, see alignment E=1.7e-16 amino acids 683 to 792 (110 residues), 42.6 bits, see alignment E=3e-15

Best Hits

Swiss-Prot: 88% identical to YBBP_ECOLI: Uncharacterized ABC transporter permease YbbP (ybbP) from Escherichia coli (strain K12)

KEGG orthology group: K02004, (no description) (inferred from 90% identity to cko:CKO_02644)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (804 amino acids)

>GFF4414 FIG00809136: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLSQQSREFMAGDRTLQSS
REVPKAWLEEARKRGLNVGEQLTFATMTFAGDTPQLASVKAVDSVYPMYGELQTRPGGVK
AQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQEPDSGFNPFQMAPRLMMNMAD
VAKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLKPEHRWYGLEQDDGALGKSLERS
QQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLGAGRAQLRKLIIGQWLMVLG
LSAVTGGAIGLLFENILLVLLKPVLPADLPPASLWPWLWALGAMTVISLLVGLRPYRLLL
ATQPLRVLRRDVVARVWPLKIYLPVACAVVVALLVGLMGGSMLLWAVLAGAVILALLCGL
VGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLSAFSLSFMLLALLLVLRGDLLDR
WQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVIPQTFYPIVRARLTKINGNPTEGQQD
ESLNRELNLTWQDTRPAHNPLVAGHWPPKPGEVSMEEGLAKRLNVKLGDSVTFMGDTQAF
SAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSWLTSFRWENGNGMLTQLNREFPTVSL
LDIGAILKQVGQVLEQVSRALEVMVVLVTLCGMLLLLAQVQVGMRQRHQELVVWRTLGAG
KKLLRTTLWCEFAMLGLVAGLVAAIGAETALAILQINVFDFPWEPDWRLWGALPFCGALL
LSVCGGWLGVRLLKGKALFRQFSG