Protein Info for GFF4405 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 9 to 89 (81 residues), 25.1 bits, see alignment E=1.2e-09 PF01757: Acyl_transf_3" amino acids 10 to 315 (306 residues), 128.1 bits, see alignment E=4.2e-41

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF4405 hypothetical protein (Xanthobacter sp. DMC5)
MSVAASPSRIHWIDYAKALGIVLVVLGHVLIGFKYAAIAKVPVAAEAVIYFIYTFHMPLF
FLLSGVVFPISKDKSFQGFLKSSLINIFVPYLIWNFIFALLKNVSPSPVNVPVGLSDIPY
VILHPVQHFWFLPYLFIIRCFYWLAERLGSSPARAGLAVVAVAWYVIASAMDLQDPIDPR
FYMGAAFFGLGCLLAERAGILPRMSRTAILAGAALVWFALAFLCYRYDVPVLGPFAALAG
VTGIVVLSFLLPAPDKPWTRTLGFLGEASLGIYVSHGIFTAAVRIALVKAGITALSLHVI
LGLLAGMIFPVALVILANRAKLSPYLGLGRNWSSRYLSSDSLRLAKPVAPAGGN