Protein Info for GFF4399 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 878 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 268 to 288 (21 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 480 to 503 (24 residues), see Phobius details amino acids 509 to 533 (25 residues), see Phobius details amino acids 555 to 581 (27 residues), see Phobius details amino acids 604 to 625 (22 residues), see Phobius details amino acids 648 to 670 (23 residues), see Phobius details amino acids 678 to 706 (29 residues), see Phobius details PF12607: DUF3772" amino acids 195 to 256 (62 residues), 60 bits, see alignment 2.3e-20 PF00924: MS_channel_2nd" amino acids 695 to 761 (67 residues), 78.6 bits, see alignment 4.8e-26 PF21082: MS_channel_3rd" amino acids 770 to 851 (82 residues), 49.8 bits, see alignment E=5.8e-17

Best Hits

KEGG orthology group: None (inferred from 76% identity to xau:Xaut_2094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (878 amino acids)

>GFF4399 hypothetical protein (Xanthobacter sp. DMC5)
MKVKTSAAFLVALALSVFPLAQAGAQQAASPPAQGQQQGQGQTQGHGQAAPAAATPNAAA
SPPAAPAAAPAGAPAAGDATPTQPVAKPAPLPPDPTIVAAREKMEAARSALDSIDAALAV
EGLRPGDLDELRQRLDPARKDLAAVSDQIAPRVADAESRLNGLGPKPAEGATEEPTIAAD
RERLTKISADLGAVLKQNRALVLRGDQISDRISSRRRALFTGQLFERVDSIIDPDLWTNA
FNALSSEFRALSYFGNDLRAYSVRRLSPLAVIGILLGGVGIMGAVVAGGRLLRKRLRTPP
PGEGESFTRLRSAREAMKVLFLNATVAPAAAMAAIAFIGAFEIIPPRAEELVQGIIIAIF
IKAIGNAVGRAFLAPNEPWRRLPQLSDAAAALAFRYYSFTVWTLAIAAALNALHRVLFAP
VGLTVVTSAIMSLLIAGFISRFLVGAARAEANADTAKETTDPSAIAATGPSQAPPRYIRL
FVWVAVFALIGALVAGYISFAAFVAARMVIAAAVLGVLYLLYALIDAFFGEGLSAETHRA
RMISSMLGLKPERVELIGVLASGLLKLQLFVVAAFLIVGSWGTSTADMMETVERVSFGVR
IGNATITLWSVVYAVLLLLVSLAAARGLQKWVSSALLPRTGLEPSLQSSIATIVGYVGTI
VAVMVAMGQLGLNLENIALVAGALSVGIGFGLQSIVSNFVSGLILLAERPIRVGDTINVK
GEEGYVRRISVRSTEIETFERATVIVPNADLITGMVKNWTHSNTTGRIIVAVTVSYDSDP
EEVRDILVGCACDHPQVLQTPPPRVFLMKFADAGIVFELRCVVANVDYALTVKSDLHFQV
LSRFRKAGVSMPSQPWAALARAPRDMVPPPPAPPDPLQ