Protein Info for GFF4397 in Xanthobacter sp. DMC5
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 79% identity to xau:Xaut_2092)Predicted SEED Role
"2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-)" (EC 3.1.1.-)
KEGG Metabolic Maps
- 2,4-Dichlorobenzoate degradation
- Alkaloid biosynthesis II
- Ascorbate and aldarate metabolism
- Glycerophospholipid metabolism
- Retinol metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.-
Use Curated BLAST to search for 3.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (256 amino acids)
>GFF4397 hypothetical protein (Xanthobacter sp. DMC5) MTETIPGETASTLDVDGRAIAIRAIPGAAPGLFWLGGFKSDMTGTKAEHLARWAQARGQA NVRFDYSGHGASGGAFEESTISRWLGEALAVFDHATSGEQVVIGSSMGGWIALLLARALA ARGEKRLKGLVLVAPAPDFTEALMWDKFPPPVRELIETSGRFLKPTLYGEDPYVITRELI EDGRRHLLLGTPFAVGCPVRILQGARDEDVPWEHAMRLVSCLAEDDVVFSLIKDGDHRLS RPEDLERLTEAVEGLV