Protein Info for GFF4395 in Xanthobacter sp. DMC5
Annotation: UTP--glucose-1-phosphate uridylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to EXON_RHIME: UTP--glucose-1-phosphate uridylyltransferase (exoN) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 91% identity to xau:Xaut_0389)Predicted SEED Role
"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)
MetaCyc Pathways
- colanic acid building blocks biosynthesis (10/11 steps found)
- UDP-α-D-glucose biosynthesis (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- sucrose biosynthesis II (5/8 steps found)
- stachyose degradation (2/7 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)
KEGG Metabolic Maps
- Galactose metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (295 amino acids)
>GFF4395 UTP--glucose-1-phosphate uridylyltransferase (Xanthobacter sp. DMC5) MRRPIRKAILPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEARAAGIEHIVFVTGR NKAVIEDHFDRQFELERTLQERGKVKELEQLDRDTPKAGTTSFTRQQLPLGLGHAVWCAR DIIGDEPFALLLPDMLHMPKNGHGCLASMVEAYNETGGNVVSVYEVPDDQTHQYGIVGTG AEAGKGAKAITQMVEKPKAGTAPSNLAISGRYILQPGIFDLLAKQERGAGNEIQLTDSML KLKETEAFYSVQFDGHVYDCGSKIGFLMANVAYALSRPDIEGEFRAELKAILGGN