Protein Info for GFF4386 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG039061: hypothetical protein related to heme utilization

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details PF04304: DUF454" amino acids 3 to 116 (114 residues), 141.4 bits, see alignment E=6.2e-46

Best Hits

Swiss-Prot: 85% identical to YBAN_SHIFL: Inner membrane protein YbaN (ybaN) from Shigella flexneri

KEGG orthology group: K09790, hypothetical protein (inferred from 98% identity to ses:SARI_02451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF4386 FIG039061: hypothetical protein related to heme utilization (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQRTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGGYL
RHWQRYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLLVILACLLIFMWRIPVIDE
KQQKR