Protein Info for GFF4385 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Primosomal replication protein N prime prime

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF07445: PriC" amino acids 8 to 173 (166 residues), 176.1 bits, see alignment E=3.2e-56

Best Hits

Swiss-Prot: 73% identical to PRIC_ECOLI: Primosomal replication protein N'' (priC) from Escherichia coli (strain K12)

KEGG orthology group: K04067, primosomal replication protein N'' (inferred from 98% identity to set:SEN0462)

MetaCyc: 73% identical to primosomal replication protein N'' (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Primosomal replication protein N prime prime" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF4385 Primosomal replication protein N prime prime (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LKTAMLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGYLEEAGANLVAL
RQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDAAAPGLGRWQRRRIQHQEFER
RLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIENVLARLTR