Protein Info for PS417_22425 in Pseudomonas simiae WCS417

Annotation: cell envelope biogenesis protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details TIGR02794: protein TolA" amino acids 15 to 352 (338 residues), 201.2 bits, see alignment E=2.8e-63 PF13103: TonB_2" amino acids 268 to 333 (66 residues), 40.1 bits, see alignment E=3.2e-14 TIGR01352: TonB family C-terminal domain" amino acids 279 to 350 (72 residues), 46.5 bits, see alignment E=3.6e-16 PF03544: TonB_C" amino acids 288 to 339 (52 residues), 29.9 bits, see alignment 6.3e-11

Best Hits

Swiss-Prot: 61% identical to TOLA_PSEAE: Tol-Pal system protein TolA (tolA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 98% identity to pfs:PFLU4909)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK45 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PS417_22425 cell envelope biogenesis protein TolA (Pseudomonas simiae WCS417)
MQQQREPSASESYFWPSVWAIALHVLVFGMLFVSFAMTPDLPPAKPIVQATLYQLKSKSQ
ATTQTNQKIAGEAQKSAARQTEVEQMEQKKVEQEAVKAAAEQKKEEAAQKAEESKKADEA
KKADEAKKADEAKKAEKAAEAKKAEEKQLADIAKKKSEEEAKKAAEEEAKKKAAEDAKKK
IVEDAKKKAAEDAKKKAEADEAKKKVADDAKKKAAADASKKKAQEAARKSAEEKKAQALA
DLLSDTPQRQQALADERGDEVAGSFDDLIRARAAEGWTRPPSARKGMTVVLQIGMLPDGT
VTSVSVSKSSGDGSFDSSAVAAVKNIGRLTEMQGMKPSDFAPYRSFKMTFTPEDLAL