Protein Info for GFF4380 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane fusion protein of RND family multidrug efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 376 (337 residues), 279.8 bits, see alignment E=1.2e-87 PF25917: BSH_RND" amino acids 64 to 207 (144 residues), 98.9 bits, see alignment E=2.9e-32 PF25876: HH_MFP_RND" amino acids 104 to 174 (71 residues), 88.9 bits, see alignment E=5.3e-29 PF25944: Beta-barrel_RND" amino acids 211 to 301 (91 residues), 122 bits, see alignment E=2.8e-39 PF25967: RND-MFP_C" amino acids 305 to 366 (62 residues), 90.5 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 92% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 99% identity to ses:SARI_02458)

MetaCyc: 92% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>GFF4380 Membrane fusion protein of RND family multidrug efflux pump (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNKNRGLTPLAVVLMLSGSLALTGCDDKQDQQGGQQMPEVGVVTLKTEPLQITTELPGRT
VAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAAN
IAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAAKAAVETARINLAYTKVTSPI
SGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQSSNDFLRLKQELANGSLKQENG
KAKVDLVTSDGIKFPQSGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLQEG
TKPTALLVPQQGVTRTPRGDATVLVVGADNKVETRQIVASQAIGDKWLVTDGLKAGDRVV
VSGLQKVRPGAQVKVQEITADNKQQAASGDQPAQPRS