Protein Info for PS417_22420 in Pseudomonas simiae WCS417

Annotation: translocation protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 19 to 429 (411 residues), 518.2 bits, see alignment E=8.3e-160 PF04052: TolB_N" amino acids 25 to 127 (103 residues), 104.8 bits, see alignment E=3.8e-34 PF07676: PD40" amino acids 198 to 228 (31 residues), 29.4 bits, see alignment (E = 8.9e-11) amino acids 237 to 272 (36 residues), 49.8 bits, see alignment 3.7e-17 amino acids 282 to 315 (34 residues), 49.4 bits, see alignment 4.7e-17

Best Hits

Swiss-Prot: 99% identical to TOLB_PSEFS: Tol-Pal system protein TolB (tolB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03641, TolB protein (inferred from 99% identity to pfs:PFLU4908)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5V8 at UniProt or InterPro

Protein Sequence (433 amino acids)

>PS417_22420 translocation protein TolB (Pseudomonas simiae WCS417)
MRNLLRGMLVVICCMAGIAAADEKNILVTSGSDRATPIAVVPFGWQGGSVLPDDMAQIVS
DDLRNSGYYAPIPKGNMISQPNQASEVVFRDWKAVGAQYLMVGNITPAGGRLQITYTLFN
VATEQQVLTGSVSGTAEQIRDMAHYISDQSFEKLTGIKGAFSTRLLYVTAERFSVDNTRY
TLQRSDYDGARAVTLLQSREPILSPRFAPDGKRIAYVSFEQKRPRIFVQHIDTGRREQIT
NFEGLNGAPAWSPDGSRLAFVLSKDGNPDIYVMNMASRQISRVTSGPGINTEPFWGKDGS
TIYFTSDRGGKPQVYKANVNGGGAERVTFIGNYNANPKLSADEKTLVMIHRQDGFTNFRV
AAQDLQRGTVKILTDTNLDESATVAPNGTMVIYATRQQGRGVLMLVSINGRVRLPLPTAQ
GEVREPSWSPYLN