Protein Info for GFF4373 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Maltose/maltodextrin ABC transporter, permease protein MalF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 283 (199 residues), 95.8 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 36% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 57% identity to vei:Veis_1880)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF4373 Maltose/maltodextrin ABC transporter, permease protein MalF (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKRIRTGSDRALLWAFGAGVAVTLLLILVPVLDAIRLSLYHAESFISIRTWVGLANYTRI
LSDETFWHALRVGLLFAVVTIAAQVVLGVLFALLLDQQFPGRPLVRGITVLPYLLPTVVV
TVIFQWLLDGGLGLFTVWSEQLGLGRPAWFENPTSAMLILIGVSVWTWTPFVTVCFLAAL
QTVPKSLYEAARVDGASAWKRFWHITIPMLAPMLTVTVLLRSIWMFNKFDVVWLLTKGGP
LSATEHLPVLSYRRAFSQFDVGGGATVATLSFLLLTLLIAVYFHYFPLEEKEAKP