Protein Info for GFF4370 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 PF13188: PAS_8" amino acids 2 to 50 (49 residues), 19.9 bits, see alignment 2.4e-07 PF13426: PAS_9" amino acids 11 to 105 (95 residues), 80 bits, see alignment E=6.4e-26 amino acids 198 to 251 (54 residues), 17.9 bits, see alignment 1.4e-06 PF08448: PAS_4" amino acids 15 to 105 (91 residues), 29.5 bits, see alignment E=3.3e-10 TIGR00229: PAS domain S-box protein" amino acids 15 to 105 (91 residues), 59.5 bits, see alignment E=1.9e-20 amino acids 136 to 251 (116 residues), 30.7 bits, see alignment E=1.5e-11 PF08447: PAS_3" amino acids 16 to 97 (82 residues), 46.9 bits, see alignment E=1.2e-15 amino acids 161 to 245 (85 residues), 60.1 bits, see alignment E=9.5e-20 PF00989: PAS" amino acids 16 to 98 (83 residues), 40.4 bits, see alignment E=1.2e-13 PF01590: GAF" amino acids 276 to 413 (138 residues), 39.5 bits, see alignment E=3.5e-13 PF00512: HisKA" amino acids 458 to 520 (63 residues), 39.6 bits, see alignment 2e-13 PF02518: HATPase_c" amino acids 564 to 683 (120 residues), 65.2 bits, see alignment E=3.1e-21 PF00072: Response_reg" amino acids 710 to 785 (76 residues), 37.7 bits, see alignment E=9.3e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (794 amino acids)

>GFF4370 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MPMVISDPRQPDNPLVFVNDAFCRLTGYSREELVGRNCRCLQGPDTDSDAVRQIREALRN
RRSIQIDVRNYRKNGEAFWNRLSIGPVHDSAGEVIYFFASQVDATFERERLLGLESSNAS
LSAELAVRVREVETGEARLRAATDAAELGIWRLDLTTSSLYASVHCKRNFGRGESLPFTY
EDLQEAVHPDDLPRMRSAVLRTIETGDDYRIEYRVVRPDGQLAWVRIVGRLERDASGHPL
SMAGTSQDITDVMLALRRNELLEMLDHDVYGVVLEPHEIAYRAAAALGRVLDVSRAGYGV
VDTQAETITIERDWNAPGITTIAGTLRFRDHGSYIEDLKRGETAIVEDARLDPRTRDSAD
ALIAISARSFINMPVSEAGGLVALLYLNHATARPWTSKELSLVREVAHRTRQAVERRRAE
QELRALAESLECKVQERTAELMKAEATLRQSQKMEAVGQLTGGLAHDFNNLLGAISGSLE
LLKRKLEDNPGLSRYVDIGQTATKRAAALTHRLLAFSRQQTLEPKVVKVNQLVGGFEELV
RRAIGPQVALEVVAGIGIWPVHVDPGQLENALLNLCINARDAMPGGGRLVIETANRSLDE
LAASEHQMLPGQYVSISVSDNGSGMPVDVIARAFDPFFTTKPIGVGTGLGLSMVYGFARQ
SGGHARIYSEVGTGTNVCMYLPRYEGGECAADDLPASNQVPQSTGVGEIVLVVDDEASVR
MLMVETLVDLGYRVLHAADGPQAVELLQANRSVALLVTDVGLPKGMNGRQVADAGRLINP
SLRVLFGERPVQPS