Protein Info for GFF4367 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF03737: RraA-like" amino acids 5 to 152 (148 residues), 126.3 bits, see alignment E=6.3e-41 TIGR01935: RraA family" amino acids 5 to 152 (148 residues), 158.8 bits, see alignment E=4.3e-51

Best Hits

Swiss-Prot: 45% identical to RRAAH_AROAE: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (AZOSEA25360) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 45% identity to eba:ebA4476)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF4367 no description (Variovorax sp. SCN45)
MTMKTAQLCDLAGERARVCVGPWRSFGASRNFSGRVCTIKTFEDAALIRTRLCTPGQGRV
LVVDAGGSLRVAVLGDQMARIGAQSGWSGILAHGAVRDVDELAHIELGVCALGSVPARGS
KSGVGACDVALSIRGVQVKPGDFMAIDADGVVFTDEPPTAA