Protein Info for GFF4362 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00702: Hydrolase" amino acids 3 to 224 (222 residues), 32.4 bits, see alignment E=1.9e-11 PF05116: S6PP" amino acids 4 to 79 (76 residues), 25.7 bits, see alignment E=1.3e-09 amino acids 144 to 238 (95 residues), 46.4 bits, see alignment E=6.2e-16 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 229 (225 residues), 181.4 bits, see alignment E=2.6e-57 TIGR00099: Cof-like hydrolase" amino acids 5 to 258 (254 residues), 197.1 bits, see alignment E=4.1e-62 PF08282: Hydrolase_3" amino acids 6 to 258 (253 residues), 182.8 bits, see alignment E=1.6e-57

Best Hits

Swiss-Prot: 100% identical to COF_SALPK: HMP-PP phosphatase (cof) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K11938, HMP-PP phosphatase [EC: 3.6.1.-] (inferred from 99% identity to sec:SC0499)

MetaCyc: 81% identical to HMP-PP phosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; Pyridoxal phosphatase. [EC: 3.1.3.74]

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.1.3.74 or 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF4362 HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MARLAAFDMDGTLLMPDHHLGRETIATLARLRERDITLTFATGRHVLEMRHILGTLSLDA
YLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRASMHVFNDNGWFTGQEIPALL
QAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLRIQLNEALEERAHLCFSAVDCL
EVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDREMLGSVGRGLIMGNAMPQLIAAL
PHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE