Protein Info for GFF4359 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR03707: polyphosphate kinase 2" amino acids 171 to 398 (228 residues), 388.2 bits, see alignment E=6.8e-121 PF03976: PPK2" amino acids 173 to 397 (225 residues), 347.6 bits, see alignment E=1.7e-108

Best Hits

KEGG orthology group: None (inferred from 61% identity to rme:Rmet_4762)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>GFF4359 hypothetical protein (Xanthobacter sp. DMC5)
VPDPLTLHAAGTGRENPAPYLPSALISINALQPAKAHVFTRFFSRGWRASAPKEHSMAST
DDLPHAAGTDAIPAEMERSLAEERQLAAQEAELSAVAALSASLETAQPTTAAGVDDVKAG
IAAILAGASPDDAVRLRKSLGMPKPTGQPRVTSDELSDDWRTGGYPFKYKMLRRDYEQQK
FILQTELLKLQSWVKDSRQRVIILFEGRDAAGKGGAIKRFMEHLNPRGARVVALEKPSEV
ERGQWYFQRYVEHLPTTGEIVMFDRSWYNRAGVERVMGFCTDDEYREFLRQAPEFERNLV
RSGIHLIKFWFSVSQDEQRRRFKERKVHPLKQWKLSPVDLASLDKWDDYTRAKEAMFFHT
DTADSPWTVIKSDDKKRARINAMRYVLHSLPYKDKDQKRIGPVEALLVGRANTVHERGEY
VMGGR