Protein Info for GFF4359 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 4-hydroxybenzoyl-CoA thioesterase family active site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF20791: Acyl-ACP_TE_C" amino acids 3 to 105 (103 residues), 31.7 bits, see alignment E=3e-11 PF01643: Acyl-ACP_TE" amino acids 4 to 126 (123 residues), 27.3 bits, see alignment E=5.2e-10 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 7 to 118 (112 residues), 122.5 bits, see alignment E=5.7e-40 PF13279: 4HBT_2" amino acids 11 to 127 (117 residues), 75.8 bits, see alignment E=8e-25 PF03061: 4HBT" amino acids 16 to 97 (82 residues), 54.1 bits, see alignment E=3.1e-18

Best Hits

Swiss-Prot: 95% identical to FADM_ECOLI: Long-chain acyl-CoA thioesterase FadM (fadM) from Escherichia coli (strain K12)

KEGG orthology group: K12500, thioesterase III [EC: 3.1.2.-] (inferred from 95% identity to eco:b0443)

MetaCyc: 95% identical to long-chain acyl-CoA thioesterase FadM (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>GFF4359 4-hydroxybenzoyl-CoA thioesterase family active site (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMTARNIAFVVVNININY
RRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALITFVCIDLKTQKALPLE
GELREKLEQMVQ