Protein Info for GFF4357 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08450: SGL
  • amino acids 44 to 282 (239 residues), 156.5 bits, E=4.7e-50

Best Hits

KEGG orthology group: K01053, gluconolactonase [EC: 3.1.1.17] (inferred from 61% identity to bxe:Bxe_C0969)

Predicted SEED Role

"Gluconolactonase"

MetaCyc Pathways

• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sorbitol biosynthesis II (1/3 steps found)
• L-ascorbate biosynthesis IV (animals, D-glucuronate pathway) (3/6 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• glucose degradation (oxidative) (2/5 steps found)
• L-ascorbate biosynthesis VI (plants, myo-inositol pathway) (1/4 steps found)
• L-ascorbate biosynthesis VIII (engineered pathway) (2/7 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Caprolactam degradation
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.17

Protein Sequence (304 amino acids)

>GFF4357 hypothetical protein (Xanthobacter sp. DMC5)
MFAAPPAVVARPFVVMPDALRIEGRRSEWSEVQFGGVPLTTFLEGPSFDRAGNLWVVDIP
WGRLIKVTPQGKVSVEAEYDGEPNGLKFHKDGRGFIADHRHGIMVFDPATGRVEPYLERA
MLQRFKGVNDLIFAANGDLYFTDQGQTGLHDPSGCLYRLRTDGRLDCVLKGIPSPNGLVL
NKTETVLFLAVTRANAIWRVPLMRDGTASKVGTFIQLSGGGGPDGLAIDEEDNLVICHMG
LGSVWLFSALGEPMLRIRSPEGHLTTNCAFGGPDNRTLFITESKTGTILCADLPVPGRRM
YSHA