Protein Info for GFF4354 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 97 to 127 (31 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 462 to 484 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 2 to 160 (159 residues), 34.7 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to xau:Xaut_0830)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>GFF4354 hypothetical protein (Xanthobacter sp. DMC5)
MGLIGILVGLAVLIFLAFRGSSILILAPIAGLIAAAFSGEPLLASWTQTFMRNAADFVAQ
FFPLFLLGAVFGKLMEDSGSVTSIANYMTEKLGPSRAILAVVLAGAIVTYGGVSLFVAFF
VLAPMGVALFRAAGVPRRLMPAAIALGTSTFTMSAMPGTPSIQNAIPMPFFGTTPFAAPG
LGIIASLIMLGFGMWWLKRRENAARAAGEGFGSLIAAPDESADLAADDPIVRERASTAGP
FDPSEIHSSDESPRAPPILLAALPIVVVIVVNLLMSFVVLPRMDVSFLADPQWGGVTLSA
VGGVWSVIVALAAAIVTCIIINFTSVPELRATMTAGANASVLPILSVASLVGFGAIVAAL
PAFTDVRNFVLGIEGGPLVSLAVATNILAALTGSASGGLTIALDALGPTYMKIAHEIGMD
PSLMHRVAVIGSGTLDSLPHNGAVVTLLSVCGVTHKEGYLDIVMAAVVGALIALAVVIGL
GTLAGSF