Protein Info for GFF4353 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF10604: Polyketide_cyc2" amino acids 4 to 140 (137 residues), 36.2 bits, see alignment E=7.4e-13 PF03364: Polyketide_cyc" amino acids 12 to 137 (126 residues), 118.3 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 46% identical to RATA_PSEAE: Ribosome association toxin RatA (ratA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 70% identity to ajs:Ajs_2551)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>GFF4353 Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKTIHKSVLLWHSAHEMFALVTDIERYPQFLPWCDQAQVLETHESGMVAKVGIAISGLRQ
SFTTRNSHEADRRLHMELVDGPFSQLDGVWEFIPLGDGGQRACKVDLKLSYGFASSALAA
LVGPVFDKIAGSLVDAFVKRADQVYGTD