Protein Info for PS417_22280 in Pseudomonas simiae WCS417

Annotation: septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details PF04279: IspA" amino acids 1 to 187 (187 residues), 202.1 bits, see alignment E=4.1e-64 TIGR00997: intracellular septation protein A" amino acids 1 to 186 (186 residues), 176.6 bits, see alignment E=2.8e-56

Best Hits

Swiss-Prot: 94% identical to YCIB_PSEFS: Probable intracellular septation protein A (PFLU_4881) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06190, intracellular septation protein (inferred from 94% identity to pfs:PFLU4881)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0U5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>PS417_22280 septation protein A (Pseudomonas simiae WCS417)
MKQFIDFIPLLLFFIVTKLDPRVIEIAGHELSFGGIYSATAVLIISSIVVYGAIFISQRK
LEKSQWLTLVACLVFGGLTLAFHSETFLKWKAPVVNWLFALVFIGSHFIGDRLLIKRIMG
HALTLPDPVWTRLNVAWIVFFLFCGAANLFVAFTFQDYWVDFKVFGSLAMTVLFLVGQGI
YLSRHLHDVAPTTPKTED