Protein Info for GFF4348 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 64 to 314 (251 residues), 97.5 bits, see alignment E=3.9e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>GFF4348 hypothetical protein (Variovorax sp. SCN45)
MAVVPGVSGLSAVAPRAATSPRPSSAEGTARARGAGLLKPGIVVVVLIVLGLFVPSVLKS
TFYLGLLVNAITLGIAALAIGFLAHQSGLMMFGAAAFTGSATYLFAIAVTQFGWNAMTAA
AFTLVGATLLSALIGALVVRARPLPFAMLTLALAQMLRSLVMVTDFRPITGGDDGLALNF
SGTFFGLTQAQLSTPEGFWPVAWLALCGVMLLAWAAGRSRTGSVLRAIRSNEERMRFSGF
NTYLPRVLAFTLSGFIAAVSGLLTGLYTAFASPELLDFATGGNALVSTLVGGISTVAGPV
LGALLYVVGQDQFGATGHLELLTGLGVVLVIVAFPEGIMGFIRNGIARLFKRGAHAVPNA
PVKKGADHAAR