Protein Info for GFF4346 in Xanthobacter sp. DMC5

Annotation: Putative zinc metalloprotease Rip3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details PF02163: Peptidase_M50" amino acids 47 to 121 (75 residues), 58.5 bits, see alignment E=6.3e-20 amino acids 141 to 197 (57 residues), 30.6 bits, see alignment E=2.2e-11 PF00571: CBS" amino acids 239 to 294 (56 residues), 33.3 bits, see alignment 4.9e-12 amino acids 303 to 352 (50 residues), 19 bits, see alignment 1.5e-07

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_1988)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF4346 Putative zinc metalloprotease Rip3 (Xanthobacter sp. DMC5)
MPWSLTIGRLGETAIRIHVTFLLFLVWIWAAYYRSGGSQAAWEGVLFVALLFFCVLLHEL
GHVFAARRYGVKTPDITLWPFGGIANLERIPEKPSQELVVAIAGPAVNVVIAVALLVVLS
FTLAGGDLKAEDLAKIEDPRTSMLVKLAGANIFLVLFNLIPAFPMDGGRVLRALLAMNMG
FARATAVAAFIGQGLAIGLGLLGIFTNPMLMIIGVFVFLAASGEAGQVQLREASRGHIVA
DAMITHFETLGPQSTVDDAAEALIRSTQKEFPVVDGAGHLRGVLTRDAMIRALKEQGPTT
PVIEVMQHDIPTVEARSKLDAALKLITSAQVPAVGVLDAPGGRLVGLLTPENVGELMMIH
VARDARSQNQPTA