Protein Info for GFF4346 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 4 to 230 (227 residues), 409.2 bits, see alignment E=1.9e-127 PF00116: COX2" amino acids 140 to 209 (70 residues), 24.3 bits, see alignment E=2.6e-09 PF06481: COX_ARM" amino acids 230 to 276 (47 residues), 62 bits, see alignment 3.8e-21

Best Hits

Swiss-Prot: 96% identical to CYOA_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 99% identity to seh:SeHA_C0545)

MetaCyc: 96% identical to cytochrome bo3 subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF4346 Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAWKY
RASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPLAHDEKPITI
EVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGM
QTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATKDRAEFDQWVAKAKQSPNTMNDMA
AFEKVAMPSEYNKVEYFSSVKPDLFKDVINKFMGHGKSMDMTQPEGEHSSHEGMEGMDMS
HAESANSKG