Protein Info for GFF4343 in Variovorax sp. SCN45

Annotation: Acyl-CoA dehydrogenase MSMEG_2070

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF02771: Acyl-CoA_dh_N" amino acids 33 to 138 (106 residues), 23 bits, see alignment E=1.7e-08 PF02770: Acyl-CoA_dh_M" amino acids 148 to 243 (96 residues), 62.9 bits, see alignment E=5.4e-21 PF00441: Acyl-CoA_dh_1" amino acids 255 to 405 (151 residues), 135.7 bits, see alignment E=3e-43 PF08028: Acyl-CoA_dh_2" amino acids 272 to 382 (111 residues), 35.8 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 63% identity to tcu:Tcur_0774)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF4343 Acyl-CoA dehydrogenase MSMEG_2070 (Variovorax sp. SCN45)
MDYQFPPEITAKLAELDAFIEAEIKPLEREHMQFFDHRREHARTDWENDGFPRKEWHDLI
AEMERRADKAGHLRYGLPKACGGQAASNLAIAAIREHLAAKGLGLHNDLQDESSIVGNFP
IVPVINAYGTTEQKRYIEGIIRRDLHLSFGLTEPNHGSDATWLETTGVRDGDGWVINGMK
RFNSQVQRAHANLVFARTSGKPGDALGITAFIVPTDTPGHRIAYNHWTFNMPSDHAEVEL
KNVRVPNSAILHEEGQGLVLAQRFIHENRIRQAAASAGAARYCIAESAKYAVNRIAFGEP
LSKKQAIQFPLVELYAECEMVRNFIFQVASRMDQQDPLEISDLVSICNFRANRLCCEAAD
RAIQVHGGIGYTRGLPFEHIYRHHRRYRITEGSEEMQMRRVAQHLFGFAGKRATA