Protein Info for GFF4341 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00027: cNMP_binding" amino acids 35 to 116 (82 residues), 47.2 bits, see alignment E=3.5e-16 PF13545: HTH_Crp_2" amino acids 149 to 224 (76 residues), 76.1 bits, see alignment E=3.4e-25 PF00325: Crp" amino acids 175 to 206 (32 residues), 48.5 bits, see alignment 1.2e-16 PF13412: HTH_24" amino acids 177 to 207 (31 residues), 23.2 bits, see alignment 8.2e-09

Best Hits

Swiss-Prot: 40% identical to FNRL_RHOS4: Transcriptional activator protein FnrL (fnrL) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 55% identity to sch:Sphch_3400)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>GFF4341 hypothetical protein (Sphingobium sp. HT1-2)
MNACTQCAVRDKAICHSLPEESLEGLNRLGRHQIVKKGQALVWQGDESLLVGNVLEGALK
LSVSSADGRDQTLGIVLPSDFIGRPFGATSMHSVIALTDSRVCTFSRSAFDTFAQDHQPL
EHGLLERTLTDLDRARQWMMMLARKSAGERVAIFLLHIAKRHSSDKSDGPLRFELPLSRQ
DMADLLGLTIETVSRQITRLRDDGIITTPSRRAIVILDQDALEACTGEC