Protein Info for GFF4340 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: corresponds to STY0478 from Accession AL513382: Salmonella typhi CT18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF08238: Sel1" amino acids 55 to 84 (30 residues), 24.7 bits, see alignment (E = 1.4e-09) amino acids 94 to 115 (22 residues), 13.4 bits, see alignment (E = 5.1e-06) amino acids 237 to 275 (39 residues), 28.8 bits, see alignment 6.8e-11 amino acids 276 to 304 (29 residues), 12.5 bits, see alignment (E = 1e-05) amino acids 319 to 344 (26 residues), 20.2 bits, see alignment (E = 3.7e-08)

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to stm:STM0437)

Predicted SEED Role

"corresponds to STY0478 from Accession AL513382: Salmonella typhi CT18"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>GFF4340 corresponds to STY0478 from Accession AL513382: Salmonella typhi CT18 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEIKFLSLCILAGVLFVSQVNASANNGKDDVKYAALTQKDLDALPVEKRASVLDELGFIH
EYGLSVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAKDSAQANKYAKKMNLDN
LLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNRPESDALFFSRIGFNQEK
TFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYQARPASLKWFRAAAEKGVVEAQS
LLGGIYSGGEGDEWGIKPDIQEAQKWYGQAAKQGDSDAQIALGKIYYSGATGRTDYAKAL
ALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYYKKASRYVGKKVEEKIFLSKC
AADIQSRKNNADALPKVTLKKERIFSRGITAKPKECALIFQIGTDKIRNMANLHITLELK
NADGMATEETLMIPPFGLNTLGIDMQNHDVDPLVTPYDLPLYTQDFCHGIGDIHFTLKSA
TATINGKNVDLLKADSVRFLDKE